hattrick.de ★★★★★ Deutschlands Sport Shop ✔ Günstige Preise ✔ Schnelle Lieferung ✔ Große Auswahl ✔ Fußballschuhe und Sportbekleidung ✔ Alles für die hattrick Freunde ✔

2.54 Rating by CuteStat

It is a domain having de extension. It has a global traffic rank of #6395139 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, hattrick.de is SAFE to browse.

PageSpeed Score
2
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 132
Daily Pageviews: 264

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: 807
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 13,000,000
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 6,395,139
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

78.47.225.170

Hosted Country:

Germany DE

Location Latitude:

51.2993

Location Longitude:

9.491
hattrick.de | Der Onlineshop für Sportartikel, Fußball Bekleidung, Fa

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: 8 H4 Headings: 17
H5 Headings: 3 H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 49
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 78.47.225.170)

Krajina24h

- krajina24h.net
3,081,013 $ 240.00

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Sun, 15 Dec 2019 16:54:55 GMT
Server: Apache/2.4.10 (Debian)
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 42197
Content-Type: text/html; charset=iso-8859-1

Domain Nameserver Information

Host IP Address Country
will.ns.cloudflare.com 108.162.193.149 United States of America United States of America
sue.ns.cloudflare.com 108.162.192.145 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
hattrick.de A 296 IP: 78.47.225.170
hattrick.de NS 86400 Target: sue.ns.cloudflare.com
hattrick.de NS 86400 Target: will.ns.cloudflare.com
hattrick.de SOA 3600 MNAME: sue.ns.cloudflare.com
RNAME: dns.cloudflare.com
Serial: 2031161156
Refresh: 10000
Retry: 2400
Expire: 604800
Minimum TTL: 3600
hattrick.de MX 300 Priority: 10
Target: mx00.kundenserver.de
hattrick.de MX 300 Priority: 11
Target: mx01.kundenserver.de

Similarly Ranked Websites

SMS Marketing | Group Text Reminders

- rockstarsmsmarketing.com

Statistics prove that nine out of every ten text messages are opened within one minute after they are received. This proves that text messages are rapidly

6,395,144 $ 8.95

ST Philips Hastings - Free Mp3 Downloads Songs Music

- stphilipshastings.com

ST Philips Hastings ✅ Free Mp3 music download ✅ Milions music audio mp3 songs and Audiobooks ✅ Price only $0 ✅ Listen music songs online ✅ Download Newest songs for FREE

6,395,151 $ 240.00

Adana Evden Eve Nakliyat ve Taşımacılık - 0322 270 00 70

- adanaevdenevenakliyatfirmalari.com

Adana evden eve nakliyat ve Adana evden eve taşımacılık firması olarak siz değerli müşterilerimize hizmet vermekten gurur duyarız. Sayısız referanslarımıza site üzerinden ulaşa bilirsiniz, dilerseniz iletişim bölümünden iletişime geçebilirsiniz.

6,395,157 $ 240.00

Gereja Gembala Yang Baik | Surabaya

- gerejagembalayangbaik.org

Website resmi Gereja Gembala Yang Baik (GYB). Tersedia jadwal misa dan berbagai hal lainnya. GYB berlokasi di Surabaya, Indonesia

6,395,158 $ 8.95

Tetio Experienced Technologies

- tetio.com
6,395,160 $ 240.00

Full WHOIS Lookup

% Restricted rights.
%
% Terms and Conditions of Use
%
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
%
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
%

Domain: hattrick.de
Nserver: sue.ns.cloudflare.com
Nserver: will.ns.cloudflare.com
Status: connect
Changed: 2016-05-15T15:40:34+02:00